PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00003103-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family ZF-HD
Protein Properties Length: 269aa    MW: 29531 Da    PI: 8.9098
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00003103-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.33.2e-3291148260
            ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                            + +rY+eClkNhAas+Ggh+vDGCgEfmp+ ge+gta++l+CaAC+CHRnFHR+ev+ e
  SMil_00003103-RA_Salv  91 CVIRYRECLKNHAASMGGHVVDGCGEFMPN-GEQGTAEGLRCAACDCHRNFHRKEVDGE 148
                            678**************************8.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-2292146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.1E-3093145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.8E-3094145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.34895144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.04E-20194266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-31196267IPR009057Homeodomain-like
PROSITE profilePS500719.572203267IPR001356Homeobox domain
TIGRFAMsTIGR015655.5E-25205262IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MERRGQERDI GLNPESESPV KLPLAAIVST PADRRGNATA PTRRGSAIFS PTQTLDHRQR  60
LKDPSPDPDP STPTAEGPSN SRTPPSPPNN CVIRYRECLK NHAASMGGHV VDGCGEFMPN  120
GEQGTAEGLR CAACDCHRNF HRKEVDGEAQ PSNLYQFRTP VVNTQTPQAA GGFGAAAPAI  180
MSFGDESSSE DLNMGGGGGH AAGSKKRFRT KFSQEQKDRM QELAEKLGWR IQKQDEQQVQ  240
QLCQETGVKR QVFKVWMHNN KQAIKKRQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-222042631675ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099626.11e-105PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9ZPW77e-63ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLK4BB303e-87K4BB30_SOLLC; Uncharacterized protein
STRINGSolyc02g085160.1.11e-86(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.12e-54homeobox protein 24